PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462886692
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family TALE
Protein Properties Length: 293aa    MW: 31816.8 Da    PI: 6.9792
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462886692genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox30.46.5e-102192542055
                HHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
   Homeobox  20 eknrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                +k +yps++e+  LA+++gL+++q+ +WF N+R ++
  462886692 219 YKWPYPSETEKIALAESTGLDQKQINNWFINQRKRH 254
                4679*****************************885 PP

2ELK38.13.2e-13174195122
        ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                ELK qLl+KYsgyL+sL+qEFs
  462886692 174 ELKYQLLKKYSGYLSSLRQEFS 195
                9********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012560.00884124IPR005541KNOX2
PfamPF037913.3E-897122IPR005541KNOX2
SMARTSM011881.2E-7174195IPR005539ELK domain
PfamPF037893.4E-10174195IPR005539ELK domain
PROSITE profilePS5121311.627174194IPR005539ELK domain
PROSITE profilePS5007112.892194257IPR001356Homeobox domain
SuperFamilySSF466898.98E-20195268IPR009057Homeodomain-like
SMARTSM003894.4E-13196261IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.605.7E-28199258IPR009057Homeodomain-like
CDDcd000862.00E-12206258No hitNo description
PfamPF059207.6E-17214253IPR008422Homeobox KN domain
PROSITE patternPS000270232255IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 293 aa     Download sequence    Send to blast
MDHSFGNLGG SSSGGSNSKA AAPASSSSFL QLPLSSAAAT GGGGGVAYYG APLALLHHAA  60
GPSSSSSLYG RHAEISPAEA DAIKAKIAPR LPEILLYREE LTRPIEEAMD FLKRVEAQLD  120
TISGAAAVGG GGGAARLLLT DGKSEGVGSS EDDMDTSGRE NEPPEIDPRA EDKELKYQLL  180
KKYSGYLSSL RQEFSKKKKK GKLPKEARQK LLHWWELHYK WPYPSETEKI ALAESTGLDQ  240
KQINNWFINQ RKRHWKPSED MPFVMMEGFH PQNAAALYMD GPFMADGMYR LGS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0160710.0AB016071.1 Oryza sativa Japonica Group mRNA, complete cds.
GenBankAK1118770.0AK111877.1 Oryza sativa Japonica Group cDNA clone:J033044D23, full insert sequence.
GenBankFJ9402080.0FJ940208.1 Oryza sativa Japonica Group clone KCB937E04 homeobox protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004955415.11e-141PREDICTED: homeobox protein rough sheath 1-like
SwissprotO650341e-120KNOSC_ORYSI; Homeobox protein knotted-1-like 12
SwissprotO804161e-120KNOSC_ORYSJ; Homeobox protein knotted-1-like 12
TrEMBLA0A0A9N8T51e-130A0A0A9N8T5_ARUDO; Rs1
STRINGMLOC_11678.11e-122(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP40613873
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G08150.11e-70KNOTTED-like from Arabidopsis thaliana